PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G085900.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 271aa    MW: 30813.5 Da    PI: 6.1723
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G085900.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-1768121356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Aqcoe3G085900.4.p  68 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARVLGLQPRQIAIWFQNRRARWK 121
                        456899***********************************************9 PP

2HD-ZIP_I/II1309.2e-4267159193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ eqvk+LE++Fe  +kLeperK++lar Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr++da+k++n++L++++++L++e++
  Aqcoe3G085900.4.p  67 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARVLGLQPRQIAIWFQNRRARWKTKQLEKDYDILKRQFDAVKDNNDALQAQNKKLQAEIM 158
                        69**************************************************************************************9997 PP

        HD-ZIP_I/II  93 e 93 
                        +
  Aqcoe3G085900.4.p 159 A 159
                        5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1952125IPR009057Homeodomain-like
PROSITE profilePS5007117.16763123IPR001356Homeobox domain
SMARTSM003892.6E-1766127IPR001356Homeobox domain
PfamPF000465.1E-1568121IPR001356Homeobox domain
CDDcd000861.25E-1568124No hitNo description
Gene3DG3DSA:1.10.10.605.4E-1970130IPR009057Homeodomain-like
PRINTSPR000312.4E-594103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000312.4E-5103119IPR000047Helix-turn-helix motif
PfamPF021838.1E-16123162IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MTCNEMDFFP TNFMFQSHHE ENHHPPTTLN PILPLCVASL LGKRSMSFSG VENGDEDLSD  60
DGSQAGEKKR RLNMEQVKTL EKNFELGNKL EPERKMQLAR VLGLQPRQIA IWFQNRRARW  120
KTKQLEKDYD ILKRQFDAVK DNNDALQAQN KKLQAEIMAL KGGEPTESIN LNKETEGSCS  180
NRSENSSEIN LDISRTPAID SPLSSNPSRP LFPTSMRPAS IVQLLQSSSR ADAHCQKSQN  240
PTQEESICHI FNAIDDQPSF WPWSENQQYH *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256832.11e-155PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC031e-103ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0S2T0071e-149A0A0S2T007_VITVI; Homodomain-leucine zipper protein ATHB-13-like protein
STRINGVIT_01s0026g01950.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-104HD-ZIP family protein